| Catalog No. | Size | Price (USD) |
| rp142789-10μg | 10μg | $73.90 |
| rp142789-50μg | 50μg | $357.90 |
| rp142789-100μg | 100μg | $571.90 |
| rp142789-1mg | 1mg | $3,763.90 |
Product Information
| Product Name | Recombinant Human Amphiregulin Protein |
| Short Description | Animal Free, >95% (SDS-PAGE&HPLC), Active, E. coli, No tag, 101-198 aa |
| Species | Human |
| Expressed Host | E. coli |
| Accession | P15514 |
| Gene Symbol | AREG |
| Gene ID | 374 |
| Amino Acids | 101-198 aa |
| Protein TAG | No tag |
| Form | Lyophilized |
| Purity | >95% (SDS-PAGE&HPLC) |
| Specifications & Purity | Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,PBS Only,≥95%(SDS-PAGE&HPLC) |
| Endotoxin Concentration | <1.0 EU/μg |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is between 5-10 ng/ml. |
| SDS Page | 11.3 kDa |
| Sequence | SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK |
| Synonyms | A REG | Amphiregulin | Amphiregulin B | AR | AREG | AREG_HUMAN | AREGB | Colorectum cell derived growth factor | Colorectum cell-derived growth factor | CRDGF | MGC13647 | Schwannoma derived growth factor | SDGF | AR | Colorectum cell-derived growth facto |
Product Description
Purity
>95% (SDS-PAGE&HPLC)
Endotoxin level
<1.0 EU/μg
Function
Bifunctional growth-modulating glycoprotein. Inhibits growth of several human carcinoma cells in culture and stimulates proliferation of human fibroblasts and certain other tumor cells.
Reconstitution
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, -20 to -70 °C under sterile conditions after reconstitution. Upon receipt, it is recommended to aliquot. Avoid freeze/th |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
