| Catalog No. | Size | Price (USD) |
| rp154124-10μg | 10μg | $139.90 |
| rp154124-50μg | 50μg | $419.90 |
| rp154124-100μg | 100μg | $679.90 |
| rp154124-1mg | 1mg | $4,449.90 |
Product Information
| Product Name | Recombinant Mouse IL-10 Protein |
| Short Description | Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 19-178 aa |
| Species | Mouse |
| Expressed Host | HEK293 |
| Accession | P18893 |
| Gene Symbol | Il10 |
| Gene ID | 16153 |
| Gene Alias | CSIF; If2a; Il-10 |
| Amino Acids | 19-178 aa |
| Protein TAG | C-His |
| Form | Lyophilized |
| Purity | ≥95% (SDS-PAGE) |
| Specifications & Purity | Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,His-Tag,≥95%(SDS-PAGE) |
| Endotoxin Concentration | <0.1 EU/μg |
| Biological Activity | Measured in a cell proliferation assay using MC/9‑2 mouse mast cells. The ED₅₀ for this effect is 0.8 ng/mL. |
| SDS Page | 20-24 kDa, under reducing conditions |
| Sequence | SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKSHHHHHH |
| Synonyms | CSIF; CSIFMGC126450; Cytokine synthesis inhibitory factor; GVHDS; IL10; IL-10; IL10A; IL-10MGC126451; interleukin 10; interleukin-10; TGIF |
Product Description
Purity
≥95% (SDS-PAGE)
Endotoxin level
<0.1 EU/μg
Function
Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
Interleukin 10 (IL-10), also known as human cytokine synthesis inhibitory factor (CSIF), is an anti-inflammatory cytokine. In humans, interleukin 10 is encoded by the IL10 gene. IL-10 signals through a receptor complex consisting of two IL-10 receptor-1 and two IL-10 receptor-2 proteins. Consequently, the functional receptor consists of four IL-10 receptor molecules. IL-10 binding induces STAT3 signalling via the phosphorylation of the cytoplasmic tails of IL-10 receptor 1 + IL-10 receptor 2 by JAK1 and Tyk2 respectively.
Reconstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
