The store will not work correctly when cookies are disabled.
Recombinant Human Calretinin/CALB2 Protein rp189283-10μg Aladdin
| Catalog No. | Size | Price (USD) |
| rp189283-10μg | 10μg | $179.90 |
| rp189283-50μg | 50μg | $539.90 |
| rp189283-100μg | 100μg | $839.90 |
| rp189283-1mg | 1mg | $4,999.90 |
Product Information
| Product Name | Recombinant Human Calretinin/CALB2 Protein |
| Short Description | Carrier Free, ≥95% (SDS-PAGE), E. coli, N-His, 2-271 aa |
| Accession | P22676 |
| Amino Acids | 2-271 aa |
| Specifications & Purity | Carrier Free,His-Tag,≥95%(SDS-PAGE),See COA |
| Endotoxin Concentration | <1.0 EU/μg |
| SDS Page | 28.1 kDa, under reducing conditions; 28.1 kDa, under non-reducing conditions. |
| Sequence | MHHHHHHAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEAGKLYRKDLEIVLCSEPPM |
| Synonyms | 29 kDa calbindin | CAB 29 | CAB29 | CAL 2 | CAL2 | CALB 2 | CALB2 | CALB2_HUMAN | Calbindin 2 | Calbindin 2 29kDa | Calbindin D29K | Calbindin2 | Calretinin | CR |
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20°C for 1 year. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
Copyright © 2025 Biogege, Inc. All rights reserved.
WhatsApp
