| Catalog No. | Size | Price (USD) |
| rp147593-10μg | 10μg | $99.90 |
| rp147593-50μg | 50μg | $299.90 |
| rp147593-100μg | 100μg | $499.90 |
| rp147593-1mg | 1mg | $2,799.90 |
Product Information
| Product Name | Recombinant Human IL-4 Protein |
| Short Description | Animal Free, ≥95% (SDS-PAGE), Active, HEK293, C-His, 25-153 aa |
| Species | Human |
| Expressed Host | HEK293 |
| Accession | P05112 |
| Gene Symbol | IL4 |
| Gene ID | 3565 |
| Amino Acids | 25-153 aa |
| Protein TAG | C-His |
| Form | Lyophilized |
| Purity | ＞98% (SDS-PAGE; HPLC ) |
| Specifications & Purity | Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His-Tag,≥95%(SDS-PAGE),See COA |
| Endotoxin Concentration | <0.1 EU/μg |
| Biological Activity | Measured in a cell proliferation assay using TF 1 human erythroleukemic cells. The ED50 for this effect is 85-340 pg/mL, corresponding to a specific activity of 2.94 × 106~1.17× 107 units/mg. |
| SDS Page | 20-23 kDa, under reducing conditions |
| Sequence | HKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSSHHHHHH |
| Synonyms | B cell growth factor 1 | BCDF | B-cell stimulatory factor 1 | BCGF1 | BCGF-1 | binetrakin | BSF1 | BSF-1 | IL4 | IL-4 | IL-4B_cell stimulatory factor 1 | IL4E12 | interleukin 4 | interleukin-4 | Lymphocyte stimulatory factor 1 | MGC79402 | Pitrakinra | B- |
Reconstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20~-80℃ long term (1 year). Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| Concentration | See COA |
