| Catalog No. | Size | Price (USD) |
| rp188342-10μg | 10μg | $159.90 |
| rp188342-50μg | 50μg | $459.90 |
| rp188342-100μg | 100μg | $735.90 |
| rp188342-1mg | 1mg | $4,899.90 |
Product Information
| Product Name | Recombinant Human CD3 zeta/CD247 Protein |
| Short Description | Carrier Free, ≥90% (SDS-PAGE), Active, E. coli, N-His, 52-164 aa |
| Accession | P20963 |
| Amino Acids | 52-164 aa |
| Specifications & Purity | Carrier Free,Bioactive,ActiBioPure™,His-Tag,≥90%(SDS-PAGE),See COA |
| Endotoxin Concentration | <1.0 EU/μg |
| Biological Activity | Immobilized Recombinant Human CD3 zeta/CD247 Protein (rp188342) at 1.0 μg/mL can bind CD3 zeta Antibody (Ab094480) with the EC50 of 70.0 ng/mL. |
| SDS Page | 15.2 kDa, under reducing conditions; 15.2 kDa, under non-reducing conditions. |
| Sequence | MHHHHHHRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR |
| Synonyms | 4930549J05Rik | A430104F18Rik | AW552088 | CD247 | CD247 antigen | Cd247 molecule | Cd3 | CD3 antigen, zeta polypeptide, isoform CRA_b | CD3 antigen, zeta subunit | CD3-eta | CD3H | CD3Q | Cd3z | CD3Z antigen zeta polypeptide (TiT3 complex) | CD3Z_HUMAN | |
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20℃ for 12 months. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| Concentration | See COA |
MDSD
