| Catalog No. | Size | Price (USD) |
| rp176261-10μg | 10μg | $119.90 |
| rp176261-50μg | 50μg | $419.90 |
| rp176261-100μg | 100μg | $559.90 |
| rp176261-1mg | 1mg | $3,399.90 |
Product Information
| Product Name | Recombinant Feline CD16 Protein |
| Short Description | Animal Free, >95% (SDS-PAGE), 293F cell, His tag, 21-207 aa |
| Expressed Host | HEK293 |
| Accession | Q9N2I5 |
| Amino Acids | 21-207 aa |
| Protein TAG | C-His |
| Form | Lyophilized |
| Purity | >95% (SDS-PAGE) |
| Specifications & Purity | Animal Free,Carrier Free,Azide Free,His Tag,PBS Only,≥95%(SDS-PAGE) |
| Endotoxin Concentration | <1.0 EU/μg |
| SDS Page | 29.6-46.9 kDa, under reducing conditions; 26.8-43.1 kDa, under non-reducing conditions |
| Sequence | ADLSKAMVVLEPEWNRVLVSDGVILKCEGAYPPGDNSAQWWHNGSVIPHRAPSYSIEAARSEDSGEYKCQTGLSEASDPVQLEVHTGWLLLQAPRWVFQEGDTIQLRCHSWKNKTVQKVQYFQDGRGKMFFHKNSDFYIPKATSKHSGSYFCRGLIGNKNESSEAVNITVQGPPVPSTSTFLPHWYQHHHHHH |
| Synonyms | D 16 | CD 16a | CD16 | CD16a | CD16a antigen | CD16B | CD16b antigen | Fc fragment of IgG | Fc fragment of IgG low affinity IIIa receptor | Fc fragment of IgG low affinity IIIa receptor (CD16) | Fc fragment of IgG receptor IIIa | Fc fragment of IgG, low a |
Product Description
Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：
Receptor for the invariable Fc fragment of immunoglobulin gamma (IgG). Optimally activated upon binding of clustered antigen-IgG complexes displayed on cell surfaces, triggers lysis of antibody-coated cells, a process known as antibody-dependent cellular cytotoxicity (ADCC). Does not bind free monomeric IgG, thus avoiding inappropriate effector cell activation in the absence of antigenic trigger (By similarity).
Mediates IgG effector functions on natural killer (NK) cells. Binds antigen-IgG complexes generated upon infection and triggers NK cell-dependent cytokine production and degranulation to limit viral load and propagation (By similarity).
Fc-binding subunit that associates with FCER1G adapter to form functional signaling complexes. Following the engagement of antigen-IgG complexes, triggers phosphorylation of immunoreceptor tyrosine-based activation motif (ITAM)-containing adapter with subsequent activation of phosphatidylinositol 3-kinase signaling and sustained elevation of intracellular calcium that ultimately drive NK cell activation (By similarity).
Mediates enhanced ADCC in response to afucosylated IgGs (By similarity).
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
