| Catalog No. | Size | Price (USD) |
| rp143327-10μg | 10μg | $129.90 |
| rp143327-50μg | 50μg | $319.90 |
| rp143327-100μg | 100μg | $499.90 |
| rp143327-1mg | 1mg | $2,499.90 |
Product Information
| Product Name | Recombinant Human BMPR2 protein |
| Short Description | Animal Free, ≥95% (SDS-PAGE), Active, HEK293, C-His tag, 27-151 aa |
| Species | Human |
| Expressed Host | HEK293 |
| Accession | Q13873-1 |
| Gene Symbol | BMPR2 |
| Gene ID | 659 |
| Amino Acids | 27-151 aa |
| Protein TAG | C-His |
| Form | Lyophilized |
| Purity | ≥95% (SDS-PAGE |
| Specifications & Purity | Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,His-Tag,≥95%(SDS-PAGE) |
| Endotoxin Concentration | <0.1 EU/μg |
| Biological Activity | Immobilized Human BMPR2 at 1 μg/mL (100 μL/well) can bind Human BMP2 with a linear range of 0.015-7.4 μg/ml. |
| SDS Page | 25-38 kDa, under reducing conditions |
| Sequence | SQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSFNRDETIHHHHHH |
| Synonyms | BMP type II receptor | BMP type-2 receptor | BMPR 2 | BMPR 3 | BMPR II | BMPR-2 | BMPR-II | Bmpr2 | BMPR2_HUMAN | BMPR3 | BMPRII | BMR 2 | BMR2 | Bone morphogenetic protein receptor type 2 | Bone morphogenetic protein receptor type II | Bone morphogenetic |
Product Description
≥95% (SDS-PAGE)
Endotoxin level
＜0.1 EU/μg
Function
On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Binds to BMP-7, BMP-2 and, less efficiently, BMP-4. Binding is weak but enhanced by the presence of type I receptors for BMPs.
Reconstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
