| Catalog No. | Size | Price (USD) |
| rp183742-10μg | 10μg | $139.90 |
| rp183742-100μg | 100μg | $693.90 |
| rp183742-1mg | 1mg | $3,399.90 |
Product Information
| Product Name | Recombinant Human MAP1LC3A Protein |
| Short Description | Carrier Free, ≥95% (SDS-PAGE), E. coli, C-His tag, 1-121 aa |
| Expressed Host | E. coli |
| Accession | Q9H492 |
| Amino Acids | 1-121 aa |
| Protein TAG | C-His |
| Specifications & Purity | Carrier Free,His-Tag,≥95%(SDS-PAGE),See COA |
| Endotoxin Concentration | <1.0 EU/μg |
| Biological Activity | Testing in progress |
| SDS Page | 13.1 kDa, under reducing conditions; 13.1 & 30.6 kDa, under non-reducing conditions |
| Sequence | MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGFHHHHHH |
| Synonyms | Autophagy related protein LC3 A | ATG8E | Autophagy related ubiquitin like modifier LC3 A | Autophagy-related protein LC3 A | Autophagy-related ubiquitin-like modifier LC3 A | LC3 | LC3A | MAP1 light chain 3 like protein 1 | MAP1 light chain 3-like protei |
Product Description
Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes) (PubMed:20713600, PubMed:24290141).
While LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (PubMed:20713600).
Through its interaction with the reticulophagy receptor TEX264, participates in the remodeling of subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006537, PubMed:31006538).
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| Concentration | See COA |
