| Catalog No. | Size | Price (USD) |
| rp183701-10μg | 10μg | $113.90 |
| rp183701-50μg | 50μg | $339.90 |
| rp183701-100μg | 100μg | $539.90 |
| rp183701-1mg | 1mg | $2,849.90 |
Product Information
| Product Name | Recombinant Human S100A4 Protein |
| Short Description | Carrier Free, ≥95% (SDS-PAGE), E. coli, C-His tag, 1-101 aa |
| Expressed Host | E. coli |
| Accession | P26447 |
| Amino Acids | 1-101 aa |
| Protein TAG | C-His |
| Specifications & Purity | Carrier Free,His-Tag,≥95%(SDS-PAGE) |
| Endotoxin Concentration | <1.0 EU/μg |
| Biological Activity | Testing in progress |
| SDS Page | 11.4 kDa, under reducing conditions; 11.4 kDa, under non-reducing conditions |
| Sequence | MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKKHHHHHH |
| Synonyms | 18A2 | 42A | Calvasculin | CAPL | CAPLS100 calcium binding protein A4 (calcium protein, calvasculin, metastasin | fibroblast-specific protein-1,42A | FSP1 | leukemia multidrug resistance associated protein | malignant transformation suppression 1 | Metast |
Product Description
S100A4, also known as metastasis-associated protein Mtsl, belongs to the family of small calcium-binding S100 proteins containing two EF-hand calcium-binding motifs. In humans at least 20 S100 family members that are distributed tissue specifically have been identified, and are involved in a number of cellular processes as transducers of calcium signal. S100A4 is a symmetric homodimer, and undergoes a relatively large conformational change upon the typical EF-hand binding calcium, which is necessary for S100A4 to interact with its protein targets and generate biological effects. It can bind the already known targets p53, F-actin, liprin β, myosin heavy chain II, and prevent their phosphorylation and multimerization.
It has been demonstrated that S100A4 is directly involved in tumor metastasis including cell motility, invasion, apoptosis, angiogenesis and differentiation, and appears to be a metastasis factor and a molecular marker for clinical prognosis. Multiple alternatively spliced variants encoding the same protein have been identified.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
