The store will not work correctly when cookies are disabled.
Recombinant Human UbcH5b/UBE2D2 Protein rp179795-10μg Aladdin
| Catalog No. | Size | Price (USD) |
| rp179795-10μg | 10μg | $179.90 |
| rp179795-50μg | 50μg | $499.90 |
| rp179795-100μg | 100μg | $799.90 |
| rp179795-1mg | 1mg | $3,999.90 |
Product Information
| Product Name | Recombinant Human UbcH5b/UBE2D2 Protein |
| Short Description | Carrier Free, ≥95% (SDS-PAGE), E. coli, No tag, 1-147 aa |
| Expressed Host | E. coli |
| Accession | P62837 |
| Amino Acids | 1-147 aa |
| Protein TAG | No tag |
| Specifications & Purity | Carrier Free, ≥95%(SDS-PAGE), See COA |
| Endotoxin Concentration | <1.0 EU/μg |
| Biological Activity | Testing in progress |
| SDS Page | 14.2 kDa, under reducing conditions; 14.2 kDa, under non-reducing conditions |
| Sequence | MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM |
| Synonyms | E2(17)KB2 | EC 6.3.2.19 | PUBC1 | UBC4/5 | UBC4ubiquitin-conjugating enzyme E2D 2 (homologous to yeast UBC4/5) | UBC5B | UBCH4 | UbcH5b | UBE2D2 | Ubiquitin carrier protein D2 | ubiquitin-conjugating enzyme E2 D2 | Ubiquitin-conjugating enzyme E2(17)KB 2 |
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
Copyright © 2025 Biogege, Inc. All rights reserved.
WhatsApp
