The store will not work correctly when cookies are disabled.
Recombinant Human/Mouse/Rat UbcH5c/UBE2D3 Protein rp179796-10μg Aladdin
| Catalog No. | Size | Price (USD) |
| rp179796-10μg | 10μg | $69.90 |
| rp179796-50μg | 50μg | $199.90 |
| rp179796-100μg | 100μg | $309.90 |
| rp179796-1mg | 1mg | $2,065.90 |
Product Information
| Product Name | Recombinant Human/Mouse/Rat UbcH5c/UBE2D3 Protein |
| Short Description | Carrier Free, ≥95% (SDS-PAGE), E. coli, No tag, 1-147 aa |
| Expressed Host | E. coli |
| Accession | P61077 |
| Amino Acids | 1-147 aa |
| Protein TAG | No tag |
| Specifications & Purity | Carrier Free, ≥95%(SDS-PAGE), See COA |
| Endotoxin Concentration | <1.0 EU/μg |
| Biological Activity | Testing in progress |
| SDS Page | 14.5 kDa, under reducing conditions; 13.8 kDa & 14.5 kDa & 29.9 kDa & 31.9 kDa, under non-reducing conditions |
| Sequence | MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM |
| Synonyms | E2(17)KB3 | MGC43926 | MGC5416 | PRO2116 | UB2D3_HUMAN | UBC 4/5 | UBC4/5 | UBC4/5 homolog yeast | UBC4/5, S. cerevisiae, homolog of | UBCH 5C | UBCH5C | Ube2d3 | Ubiquitin carrier protein | Ubiquitin carrier protein D3 | Ubiquitin conjugating enzyme E2 1 |
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| X Filter Target ID | UBE2D3 |
| Concentration | See COA |
Copyright © 2025 Biogege, Inc. All rights reserved.
WhatsApp
