| Catalog No. | Size | Price (USD) |
| rp217155-10μg | 10μg | $239.90 |
| rp217155-100μg | 100μg | $959.90 |
| rp217155-1mg | 1mg | $5,799.90 |
Product Information
| Product Name | Recombinant Human Factor VIII Protein |
| Short Description | Carrier Free, ≥95% (SDS-PAGE), E. coli, N-His, 2144-2351 aa |
| Accession | P00451 |
| Amino Acids | 2144-2351 aa |
| Specifications & Purity | Carrier Free,His-Tag,≥95%(SDS-PAGE),See COA |
| Endotoxin Concentration | <1.0 EU/μg |
| SDS Page | 25.1 kDa, under reducing conditions; 25.2 & 44.8 kDa, under non-reducing conditions. |
| Sequence | MHHHHHHVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY |
| Synonyms | AHF | Antihemophilic factor | Coagulation factor VIII | coagulation factor VIII, procoagulant component | coagulation factor VIIIc | DXS1253E | F8 | F8b | F8c | FA8_HUMAN | factor VIII F8B | Factor VIIIa light chain | FactorVIII | FVIII | Hema | Hemophili |
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20℃ for 6 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| Concentration | See COA |
