| Catalog No. | Size | Price (USD) |
| rp225846-10μg | 10μg | $259.90 |
| rp225846-50μg | 50μg | $739.90 |
| rp225846-100μg | 100μg | $999.90 |
| rp225846-1mg | 1mg | $3,999.90 |
Product Information
| Product Name | Recombinant Human Nestin Protein |
| Short Description | Carrier Free, ≥90% (SDS-PAGE), E. coli, No tag, 1040-1158 aa |
| Accession | P48681 |
| Amino Acids | 1040-1158 aa |
| Specifications & Purity | Carrier Free, ≥95%(SDS-PAGE), See COA |
| Endotoxin Concentration | <1.0 EU/μg |
| SDS Page | 29.4 kDa, under reducing conditions; 29.4 kDa, under non-reducing conditions. |
| Sequence | GDPEGQSQQVGAPGLQAPQGLPEAIEPLVEDDVAPGGDQASPEVMLGSEPAMGESAAGAEPGPGQGVGGLGDPGHLTREEVMEPPLEEESLEAKRVQGLEGPRKDLEEAGGLGTEFSELP |
| Synonyms | FLJ21841 | NES | Nestin | Nbla00170 |
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| Concentration | See COA |
