| Catalog No. | Size | Price (USD) |
| rp149360-10μg | 10μg | $95.90 |
| rp149360-50μg | 50μg | $285.90 |
| rp149360-100μg | 100μg | $469.90 |
| rp149360-1mg | 1mg | $3,399.90 |
Product Information
| Product Name | Recombinant Human Noggin Protein |
| Short Description | Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 28-232 aa |
| Species | Human |
| Expressed Host | HEK293 |
| Accession | Q13253 |
| Amino Acids | 28-232 aa |
| Protein TAG | C-His |
| Form | Lyophilized |
| Purity | ≥95% (SDS-PAGE) |
| Specifications & Purity | Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,His-Tag,≥95%(SDS-PAGE) |
| Endotoxin Concentration | <0.1 EU/μg |
| Biological Activity | Immobilized Human BMP2 at 1 μg/mL (100 μL/well) can bind Noggin with a linear range of 2-57 ng/mL. |
| SDS Page | 35-38 kDa under reducing conditions. |
| Sequence | QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSCHHHHHH |
| Synonyms | NOG | Noggin | SYM1 | symphalangism 1 (proximal) | synostoses (multiple) syndrome 1 | SYNS1 | SYNS1A |
Product Description
Essential for cartilage morphogenesis and joint formation. Inhibitor of bone morphogenetic proteins (BMP) signaling which is required for growth and patterning of the neural tube and somite.
Reconstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
