The store will not work correctly when cookies are disabled.
Recombinant Human Cdk9 Protein rp189450-10μg Aladdin
| Catalog No. | Size | Price (USD) |
| rp189450-10μg | 10μg | $199.90 |
| rp189450-50μg | 50μg | $629.90 |
| rp189450-100μg | 100μg | $999.90 |
| rp189450-1mg | 1mg | $5,999.90 |
Product Information
| Product Name | Recombinant Human Cdk9 Protein |
| Short Description | Carrier Free, ≥90% (SDS-PAGE), Active, E. coli, N-His, 2-372 aa |
| Accession | P50750 |
| Gene Symbol | CDK9 |
| Gene Alias | TAK; C-2k; CTK1; CDC2L4; PITALRE |
| Amino Acids | 2-372 aa |
| Specifications & Purity | Carrier Free,Bioactive,ActiBioPure™,His-Tag,≥90%(SDS-PAGE),expressed in E. coli, See COA |
| Endotoxin Concentration | <1.0 EU/μg |
| Biological Activity | Immobilized Recombinant Human Cdk9 Protein (rp189450) at 1.0 μg/mL can bind Recombinant Cdk9 Antibody (Ab095812) with the EC50 of 4.3 ng/mL. |
| SDS Page | 34.2 & 36.9 & 40.2 & 76.4-90.5 kDa, under reducing conditions |
| Sequence | MHHHHHHAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF |
| Synonyms | CDC2L4 | TAK | CDK9 | Cyclin-dependentkinase9 | C-2K | Celldivisioncycle2-likeproteinkinase4 | Celldivisionproteinkinase9 | Serine/threonine-proteinkinasePITALRE | Tat-associatedkinasecomplexcatalyticsubunit |
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20℃ long term (12 months). Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| Concentration | expressed in E. coli, See COA |
Copyright © 2025 Biogege, Inc. All rights reserved.
WhatsApp
