| Catalog No. | Size | Price (USD) |
| rp154245-2μg | 2μg | $59.90 |
| rp154245-10μg | 10μg | $139.90 |
| rp154245-100μg | 100μg | $699.90 |
| rp154245-1mg | 1mg | $4,559.90 |
Product Information
| Product Name | Recombinant mouse IL-7 protein |
| Short Description | Animal Free, >97%(SDS-PAGE), Active, E.coli, No tag, 26-154 aa |
| Species | Mouse |
| Source | Recombinant |
| Expressed Host | E.coli |
| Accession | Q544C8 |
| Gene Symbol | Il7 |
| Gene ID | 16196 |
| Gene Alias | Il-7; hlb368; A630026I06Rik |
| Protein Length | Full length protein |
| Amino Acids | 26-154 aa |
| Protein TAG | No tag |
| Form | Lyophilized |
| Purity | ＞97%(SDS-PAGE) |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥97%(SDS-PAGE) |
| Endotoxin Concentration | <0.01 EU/μg |
| Biological Activity | Measured in a cell proliferation assay using PHA-activated human peripheral blood mononuclear cell (PBMC). The ED50 for this effect is less than 1ng/mL。 |
| SDS Page | 12.9 kDa, under reducing conditions; 12.1 kDa, under non-reducing conditions. |
| Sequence | ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI |
| Synonyms | IL7 | IL-7 | interleukin-7 | interleukin 7 | Lymphopoietin-1 | PBGF | hlb368 | A630026I06Rik |
Product Description
Purity
>97% SDS-PAGE.
Interleukin-7 (IL-7) is encoded by the IL7 gene in mouse and secreted by stromal cells in the red marrow and thymus. The protein signals through the IL-7 receptor, which is a heterodimer consisting of IL-7 receptor alpha and IL-2 receptor gamma chain. IL-7 stimulates the differentiation of hematopoietic stem cells into lymphoid progenitor cells and it can stimulate proliferation of B cells, T cells and NK cells. Mouse IL-7 has approximately 65 % and 88 % amino acid sequence identity with human and rat IL-7 and both proteins exhibit cross-species activity. Recombinant Mouse IL-7 is a 14.9kDa globular protein containing 129 amino acid residues.
Function
Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.
Reconstitution
This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in a sterile aqueous buffer to an appropriate concentration.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | White lyophilized powder. For long term storage, the product should be stored ≤-20℃ 36 months, -20 to -70℃ as supplied. 1 month, 2 to 8℃ under sterile conditions after reconstitution; 3 months, -20 to -70℃ under sterile conditions after reconstitution. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| Application | Active, SDS-PAGE |
| N Terminal Sequence | Glu-Cys-His-Ile-Lys-Asp-Lys-Glu |
