| Catalog No. | Size | Price (USD) |
| rp147739-10μg | 10μg | $229.90 |
| rp147739-50μg | 50μg | $413.90 |
| rp147739-100μg | 100μg | $661.90 |
| rp147739-1mg | 1mg | $3,659.90 |
Product Information
| Product Name | Recombinant Human IFN-alpha-1a Protein |
| Short Description | Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 24-189 aa (Q114A) |
| Species | Human |
| Expressed Host | HEK293 |
| Accession | P01562 |
| Amino Acids | 24-189 aa (Q114A) |
| Protein TAG | C-His |
| Form | Lyophilized |
| Specifications & Purity | Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His-Tag,≥95%(SDS-PAGE) |
| Endotoxin Concentration | <0.1 EU/μg |
| Biological Activity | Measured by its ability to stimulate GBP2 expression in 293T human embryonic kidney cells. 0.1-1 ng/mL of Recombinant Human IFNA1 can effectively Stimulating GBP2 expression. |
| SDS Page | 15 - 18 kDa, under reducing conditions; 15 - 18 kDa, under non-reducing conditions. |
| Sequence | MCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYAQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKEHHHHHH |
| Synonyms | IFN-alpha-1/13 | Interferon alpha-D | LeIF D | Interferon alpha 1 | Interferon alpha-1/13 | Interferon alpha-D | Interferon alpha1 | Interferon, alpha 13 | LeIF D | IFNalpha 1 | IFN-alpha 1 | IFL | IFN | IFN alpha | IFN alpha 1/13 | IFN alpha 1b | IFN alp |
Product Description
Function
Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Reconstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
