| Catalog No. | Size | Price (USD) |
| rp183586-10μg | 10μg | $79.90 |
| rp183586-50μg | 50μg | $259.90 |
| rp183586-100μg | 100μg | $399.90 |
| rp183586-1mg | 1mg | $2,599.90 |
Product Information
| Product Name | Recombinant Human GMFB Protein |
| Short Description | Carrier Free, ≥95% (SDS-PAGE), E. coli, No tag, 2-142 aa |
| Expressed Host | E. coli |
| Accession | P60983 |
| Amino Acids | 2-142 aa |
| Protein TAG | No tag |
| Specifications & Purity | Carrier Free,PBS Only,≥95%(SDS-PAGE) |
| Endotoxin Concentration | <1.0 EU/μg |
| Biological Activity | Testing in progress |
| SDS Page | 15.1 kDa, under reducing conditions; 15.1 kDa, under non-reducing conditions |
| Sequence | SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH |
| Synonyms | GMF | GMF-beta | GMFB | GMFB_HUMAN | Glia maturation factor beta |
Product Description
This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
