| Catalog No. | Size | Price (USD) |
| rp181317-10μg | 10μg | $145.90 |
| rp181317-50μg | 50μg | $433.90 |
| rp181317-100μg | 100μg | $659.90 |
| rp181317-1mg | 1mg | $3,399.90 |
Product Information
| Product Name | Recombinant Human CCL24/Eotaxin-2/MPIF-2 Protein |
| Short Description | Carrier Free, ≥95% (SDS-PAGE), E. coli, No tag, 27-119 aa |
| Expressed Host | E. coli |
| Accession | O00175 |
| Amino Acids | 27-119 aa |
| Protein TAG | No tag |
| Specifications & Purity | Carrier Free,PBS Only,≥95%(SDS-PAGE) |
| Endotoxin Concentration | <1.0 EU/μg |
| Biological Activity | Testing in progress |
| SDS Page | 13.0 kDa, under reducing conditions; 25.0 kDa, under non-reducing conditions |
| Sequence | VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC |
| Synonyms | chemokine (C-C motif) ligand 24 | CCL24 | Ckb-6 | Eosinophil chemotactic protein 2 | Eotaxin-2 | member 24 | MPIF2 | MPIF-2 | MPIF2Myeloid progenitor inhibitory factor 2 | MPIF-2Small-inducible cytokine A24 | SCYA24CK-beta-6 |
Product Description
Protein Function:
CCL24, also known as Eotaxin-2 and MPIF-2, belongs to the intercrine beta (chemokine CC) family. CCL24 gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. CCL24 displays chemotactic activity on resting T lymphocytes, a minimal activity on neutrophils, and is negative on monocytes and activated T lymphocytes. CCL24 is also a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. CCL24 is chemotactic for resting T-lymphocytes, and eosinophils. It has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. It is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line.
Eotaxin-2 interacts with chemokine receptor CCR3 to induce chemotaxis in eosinophils. Elevated level of Eotaxin-2 has been seen in patients with aspirin-exacerbated respiratory disease.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
