| Catalog No. | Size | Price (USD) |
| rp181570-10μg | 10μg | $159.90 |
| rp181570-50μg | 50μg | $399.90 |
| rp181570-100μg | 100μg | $665.90 |
| rp181570-1mg | 1mg | $4,439.90 |
Product Information
| Product Name | Recombinant Human Cardiotrophin-1/CT-1 Protein |
| Short Description | Carrier Free, ≥95% (SDS-PAGE), E. coli, No tag, 2-201 aa |
| Expressed Host | E. coli |
| Accession | Q16619 |
| Amino Acids | 2-201 aa |
| Protein TAG | No tag |
| Specifications & Purity | Carrier Free, ≥95%(SDS-PAGE) |
| Endotoxin Concentration | <1.0 EU/μg |
| Biological Activity | Testing in progress |
| SDS Page | 22.3 kDa, under reducing conditions; 23.4 kDa, under non-reducing conditions |
| Sequence | SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA |
| Synonyms | cardiophin 1 | cardiotrophin 1 | Cardiotrophin1 | Cardiotrophin-1 | CT-1CT1 | CTF1 |
Product Description
Protein Function:
CTF1 is the first HOX11 protein partner identified that plays an important role in hematopoietic precursor cell immortalization. CTF1 was found to protect a gene from silencing when its DNA-binding sites were interposed between the gene and the telomeric extremity, while it did not affect a gene adjacent to the telomere. Protein fusions containing the CTF1 histone-binding domain displayed similar activities, while mutants impaired in their ability to interact with the histone did not. Cardiotrophin-1 (CTF1) has been reported to act as a trophic factor for a few neurons, such as sensory, cholinergic, dopaminergic, motor and cortical neurons. Studies have indicated that CTF1 delays degenerative disease progression in motor neuron disease.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
