| Catalog No. | Size | Price (USD) |
| rp144702-10μg | 10μg | $227.90 |
| rp144702-50μg | 50μg | $565.90 |
| rp144702-100μg | 100μg | $905.90 |
| rp144702-1mg | 1mg | $3,849.90 |
Product Information
| Product Name | Recombinant Human Cripto-1 Protein |
| Short Description | Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 1-172 aa |
| Species | Human |
| Expressed Host | HEK293 |
| Accession | P13385 |
| Amino Acids | 1-172 aa |
| Protein TAG | C-His |
| Form | Lyophilized |
| Specifications & Purity | Animal Free,Carrier Free,Bioactive,ActiBioPure™,His-Tag,≥95%(SDS-PAGE) |
| Endotoxin Concentration | <0.1 EU/μg |
| Biological Activity | Immobilized Recombinant Human Activin RIB/ALK‑4 protein at 2.0 µg/mL can bind Recombinant Human Cripto-1 Protein (rp144702) the ED50 is 54.4 ng/mL. |
| SDS Page | 20 - 30 kDa, under reducing conditions; 20 -30 kDa, under non-reducing conditions. |
| Sequence | MDCRKMARFSYSVIWIMAISKVFELGLVAGLGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTHHHHHH |
| Synonyms | CFC-2 | CR | Cripto | Cripto-1 growth factor | Cripto-1 | CRGF | Epidermal growth factor-like cripto protein CR1 | TDGF1 | TDGF-1 | teratocarcinoma-derived growth factor 1 | CR-1 |
Product Description
Could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm.
Reconstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
