| Catalog No. | Size | Price (USD) |
| h751559-500μg | 500μg | $228.90 |
| h751559-1mg | 1mg | $399.90 |
Product Information
| Product Name | Recombinant Human Vitronectin Protein |
| Short Description | GMP, ≥95% (SDS-PAGE), Active, CHO, No tag, 20-478 aa |
| Accession | P04004 |
| Amino Acids | 20-478 aa |
| Specifications & Purity | Animal Free,Carrier Free,Bioactive,ActiBioPure™,Low Endotoxin,High Performance,≥95%(SDS-PAGE),Embryo cell culture grade,Sterile |
| Endotoxin Concentration | <1.0 EU/mg |
| Biological Activity | Measured by the ability of the immobilized protein to support the adhesion of NIH3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 2-10 μg/mL. Optimal concentration depends on cell type as well as the application or research objectives. |
| SDS Page | 52.3 kDa |
| Sequence | DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL |
| Synonyms | Complement S Protein | Epibolin | S Protein | S-protein | Serum Spreading Factor | Serum-spreading factor | Somatomedin B | Somatomedin-B | V75 | Vitronectin | Vitronectin V10 subunit | Vitronectin V65 subunit | VN | VNT | VTN | VTNC_HUMAN |
Reconstitution
It is recommended to redissolve in sterile deionized water.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | 36 months at -20°C to -80°C in lyophilized state. 6 months at -20°C to -80°C under sterile conditions after reconstitution. 7-10 days at 2°C to 8°C under sterile conditions after reconstitution. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| Concentration | Embryo cell culture grade,Sterile |
