| Catalog No. | Size | Price (USD) |
| rp167459-gmp-50μg | 50μg | $1,419.90 |
| rp167459-gmp-1mg | 1mg | $11,359.90 |
Product Information
| Product Name | Recombinant Human Thrombopoietin GMP Protein |
| Short Description | GMP, ≥95% (SDS-PAGE&SEC-HPLC), Active, E. coli, No tag, 22-195 aa |
| Expressed Host | E. coli |
| Accession | NP_000451.1 |
| Amino Acids | 22-195 aa |
| Protein TAG | No tag |
| Specifications & Purity | Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,≥95%(SDS-PAGE&SEC-HPLC) |
| Endotoxin Concentration | <0.1 EU/μg |
| Biological Activity | Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 0.05-0.5 ng/mL. The specific activity of Recombinant Human Thrombopoietin is >1 x 10^7 units/mg, which is calibrated against the human Thrombopoietin reference standard (NIBSC code: 03/124). |
| SDS Page | 19 kDa, under reducing conditions |
| Sequence | SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL |
| Synonyms | Megakaryocyte colony-stimulating factor | Megakaryocyte growth and development factor | megakaryocyte stimulating factor | MGDF | MGDFC-mpl ligand | MKCSF | MK-CSF | ML | MPL ligand | MPLLG | MGC163194 | Myeloproliferative leukemia virus oncogene ligand | |
Reconstitution
Reconstitute at 100-200 μg/mL in sterile, deionized water.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | A minimum of 12 months when stored at ≤ -20 ℃ as supplied. 1 month, 2 to 8 ℃ under sterile conditions after reconstitution. 3 months, ≤ -28 ℃ under sterile conditions after reconstitution. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycl |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| N Terminal Sequence | Ala-Ser22-Pro-Ala-Pro-Pro-Ala-(Cys)-Asp-Leu |
MDSD
