| Catalog No. | Size | Price (USD) |
| rp181562-10μg | 10μg | $143.90 |
| rp181562-50μg | 50μg | $379.90 |
| rp181562-100μg | 100μg | $599.90 |
| rp181562-1mg | 1mg | $3,399.90 |
Product Information
| Product Name | Recombinant Human IGFBP-rp1/IGFBP-7 Protein |
| Short Description | Carrier Free, ≥95% (SDS-PAGE), Active, E. coli, No tag, 27-282 aa |
| Accession | Q16270 |
| Amino Acids | 27-282 aa |
| Specifications & Purity | Carrier Free,Bioactive,ActiBioPure™,PBS Only,≥95%(SDS-PAGE),See COA |
| Endotoxin Concentration | <1.0 EU/μg |
| Biological Activity | Immobilized Recombinant Human IGFBP-rp1/IGFBP-7 Protein (rp181562) at 3.0 μg/mL can bind Recombinant IGFBP7 Antibody (Ab109597) with the EC50 of 130.0 ng/mL. |
| SDS Page | 30.6 kDa, under reducing conditions; 27.6 & 50.5 kDa, under non-reducing conditions. |
| Sequence | SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL |
| Synonyms | AGM | Angiomodulin | FSTL2 | IBP-7 | IBP7 | IBP7_HUMAN | IGF binding protein 7 | IGF-binding protein 7 | IGFBP rP1 | IGFBP-7 | IGFBP-rP1 | IGFBP7 | IGFBPRP1 | Insulin like growth factor binding protein 7 | Insulin-like growth factor-binding protein 7 | MA |
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20°C for 1 year. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| Concentration | See COA |
