| Catalog No. | Size | Price (USD) |
| rp186574-10μg | 10μg | $279.90 |
| rp186574-50μg | 50μg | $799.90 |
| rp186574-100μg | 100μg | $1,279.90 |
| rp186574-1mg | 1mg | $6,999.90 |
Product Information
| Product Name | Recombinant Human Cytokeratin 9 Protein |
| Short Description | Carrier Free, ≥95% (SDS-PAGE), E. coli, N-His, 254-456 aa |
| Expressed Host | E. coli |
| Accession | P35527 |
| Amino Acids | 254-456 aa |
| Protein TAG | N-His |
| Specifications & Purity | Carrier Free,His-Tag,≥95%(SDS-PAGE) |
| Endotoxin Concentration | <1.0 EU/μg |
| SDS Page | 27.6 kDa, under reducing conditions; 27.6 & 55.0 kDa, under non-reducing conditions. |
| Sequence | MHHHHHHDADINGLRQVLDNLTMEKSDLEMQYETLQEELMALKKNHKEEMSQLTGQNSGDVNVEINVAPGKDLTKTLNDMRQEYEQLIAKNRKDIENQYETQITQIEHEVSSSGQEVQSSAKEVTQLRHGVQELEIELQSQLSKKAALEKSLEDTKNRYCGQLQMIQEQISNLEAQITDVRQEIECQNQEYSLLLSIKMRLEKEIETYHN |
| Synonyms | Keratin, type I cytoskeletal 9 | Cytokeratin-9 (CK-9) | Keratin-9 (K9) | KRT9 | EPPK | K9 | Keratin 9 | Cytokeratin 9 | Type I Cytoskeletal 9 | Epidermolytic Palmoplantar Keratoderma |
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20°C for 1 year. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
