| Catalog No. | Size | Price (USD) |
| rp189416-10μg | 10μg | $139.90 |
| rp189416-50μg | 50μg | $399.90 |
| rp189416-100μg | 100μg | $629.90 |
| rp189416-1mg | 1mg | $4,899.90 |
Product Information
| Product Name | Recombinant Human DUSP19 Protein |
| Short Description | Carrier Free, ≥95% (SDS-PAGE), E. coli, N-His, 65-217 aa |
| Accession | Q8WTR2 |
| Amino Acids | 65-217 aa |
| Specifications & Purity | Carrier Free,His-Tag,≥95%(SDS-PAGE),See COA |
| Endotoxin Concentration | <1.0 EU/μg |
| SDS Page | 16.1 & 31.8 kDa, under reducing conditions; 16.0 & 30.4 kDa, under non-reducing conditions. |
| Sequence | MHHHHHHQVGVIKPWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSYFPECFEFIEEAKRKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS |
| Synonyms | dual specificity phosphatase 19, Dual specificity phosphatase TS-DSP1, dual specificity protein phosphatase 19, DUSP17SAPK pathway-regulating phosphatase 1, EC 3.1.3.16, EC 3.1.3.48, LMWDSP3, LMW-DSP3, Low molecular weight dual specificity phosphatase 3, |
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20℃ for 6 months. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| Concentration | See COA |
MDSD
