| Catalog No. | Size | Price (USD) |
| rp189386-10μg | 10μg | $139.90 |
| rp189386-50μg | 50μg | $399.90 |
| rp189386-100μg | 100μg | $629.90 |
| rp189386-1mg | 1mg | $3,699.90 |
Product Information
| Product Name | Recombinant Human DGCR6L Protein |
| Short Description | Carrier Free, ≥90% (SDS-PAGE), E. coli, N-His, 2-220 aa |
| Accession | Q9BY27 |
| Amino Acids | 2-220 aa |
| Specifications & Purity | Carrier Free,His-Tag,≥90%(SDS-PAGE),See COA |
| Endotoxin Concentration | <1.0 EU/μg |
| SDS Page | 26.5 kDa, under reducing conditions; 26.5 kDa, under non-reducing conditions. |
| Sequence | MHHHHHHERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQKIILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQCDQKGSPVPP |
| Synonyms | DGC6L_HUMAN | DGCR6L | DiGeorge syndrome critical region 6-like protein | Protein DGCR6L |
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20℃ for 12 months. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| Concentration | See COA |
MDSD
