| Catalog No. | Size | Price (USD) |
| rp192080-10μg | 10μg | $89.90 |
| rp192080-50μg | 50μg | $269.90 |
| rp192080-100μg | 100μg | $429.90 |
| rp192080-1mg | 1mg | $2,599.90 |
Product Information
| Product Name | Recombinant Human EMC2 Protein |
| Short Description | Carrier Free, ≥95% (SDS-PAGE), E. coli, N-His, 2-297 aa |
| Accession | Q15006 |
| Amino Acids | 2-297 aa |
| Specifications & Purity | Carrier Free,His-Tag,≥95%(SDS-PAGE),See COA |
| Endotoxin Concentration | <1.0 EU/μg |
| SDS Page | 30.5 kDa, under reducing conditions; 29.3 & 31.4 kDa, under non-reducing conditions. |
| Sequence | MHHHHHHAKVSELYDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWIIYEQVMIAALDYGRDDLALFCLQELRRQFPGSHRVKRLTGMRFEAMERYDDAIQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEAIRELNEYLEQFVGDQEAWHELAELYINEHDYAKAAFCLEELMMTNPHNHLYCQQYAEVKYTQGGLENLELSRKYFAQALKLNNRNMRALFGLYMSASHIASNPKASAKTKKDNMKYASWAASQINRAYQFAGRSKKETKYSLKAVEDMLETLQITQS |
| Synonyms | ER Membrane Protein Complex Subunit 2 | KIAA0103 | Tetratricopeptide Repeat Domain 35 | Tetratricopeptide Repeat Protein 35 | TPR Repeat Protein 35 | TTC35 |
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20℃ for 6 months. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| Concentration | See COA |
MDSD
