| Catalog No. | Size | Price (USD) |
| rp150852-10μg | 10μg | $39.90 |
| rp150852-50μg | 50μg | $89.90 |
| rp150852-1mg | 1mg | $969.90 |
Product Information
| Product Name | Recombinant Human RANK/TNFRSF11A Protein |
| Short Description | Animal Free, ≥95% (SDS-PAGE), Active, HEK293, C-His & hFc, 29-213 aa |
| Species | Human |
| Accession | Q9Y6Q6 |
| Amino Acids | 29-213 aa |
| Form | Liquid |
| Specifications & Purity | Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His-Tag,Fc tag,≥95%(SDS-PAGE) |
| Endotoxin Concentration | <0.1 EU/μg |
| Biological Activity | Measured by its ability to inhibit TRANCE-induced osteoclast differentiation of RAW 264.7 mouse monocyte/macrophage cells. The ED50 for this effect is 0.005‑0.035 µg/mL in the presence of 2 ng/mL of rmTRANCE. |
| SDS Page | 60 kDa, under reducing conditions. |
| Sequence | MQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLPGMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Synonyms | ODFR | Osteoclast differentiation factor receptor | Receptor activator of NF-KB | CD265 antigen | CD265 | FEO | loss of heterozygosity, 18, chromosomal region 1 | ODFR | ODFROSTS | OFE | OPTB7 | Osteoclast differentiation factor receptor | PDB2 | RANK | L |
Reconstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| Protein Construction | Disulfide-linked homodimer |
