| Catalog No. | Size | Price (USD) |
| rp156658-50μg | 50μg | $299.90 |
| rp156658-100μg | 100μg | $399.90 |
| rp156658-1mg | 1mg | $2,859.90 |
Product Information
| Product Name | Recombinant Human TAGLN/Transgelin Protein |
| Short Description | Carrier free, >90% (SDS-PAGE), E.coli, N-His tag, 1-201 aa |
| Species | Human |
| Expressed Host | E. coli |
| Accession | Q01995 |
| Gene Symbol | TAGLN |
| Gene ID | 6876 |
| Gene Alias | SM22; SMCC; TAGLN1; WS3-10; SM22-alpha |
| Amino Acids | 1-201 aa |
| Protein TAG | N-His |
| Form | Lyophilized |
| Purity | ＞90% (SDS-PAGE) |
| Specifications & Purity | Carrier Free,Azide Free,His Tag,PBS Only,≥90%(SDS-PAGE) |
| SDS Page | 17.5-26.0 kDa |
| Sequence | MGHHHHHHMANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS |
| Synonyms | 22 kDa actin-binding protein | Protein WS3-10 | SM22 | SM22-alpha | Smooth muscle protein 22-alpha | TAGL_HUMAN | TAGLN | Transgelin | WS3-10 | 22 kDa actin-binding protein | Protein WS3-10 | SM22-alpha | Smooth muscle protein 22-alpha |
Product Description
Purity:
>90%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Function：
Actin cross-linking/gelling protein (By similarity). Involved in calcium interactions and contractile properties of the cell that may contribute to replicative senescence.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20°C for 1 year, store at 2-8℃ for 1 month. Avoid freeze / thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
