| Catalog No. | Size | Price (USD) |
| rp156672-10μg | 10μg | $127.90 |
| rp156672-50μg | 50μg | $399.90 |
| rp156672-100μg | 100μg | $791.90 |
| rp156672-1mg | 1mg | $3,399.90 |
Product Information
| Product Name | Recombinant Human Parvalbumin Protein |
| Short Description | Carrier Free, >90%(SDS-PAGE), E.coli, C-His tag, 1-110 aa |
| Expressed Host | E. coli |
| Accession | P20472 |
| Gene Symbol | PVALB |
| Gene ID | 19293 |
| Amino Acids | 1-110 aa |
| Protein TAG | C-His |
| Form | Lyophilized |
| Specifications & Purity | Carrier Free,Azide Free,His Tag,PBS Only,≥90%(SDS-PAGE) |
| Endotoxin Concentration | <1.0 EU/μg |
| SDS Page | 11.6 kDa, reducing conditions; 11.6 kDa, non-reducing conditions |
| Sequence | MGMSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAESHHHHH |
| Synonyms | PVALB Protein | Parvalbumin Alpha | D22S749 | MGC116759 |
Product Description
Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：Parvalbumin α (PVALB) is a member of the parvalbumin family. PVALB is a high affinity calcium ion-binding protein, with two EF hand domains. PVALB is structurally and functionally similar to calmodulin and troponin C, it can bind two calcium ions. Parvalbumin is thought to be involved in relaxation after contraction in muscle. Parvalbumin is expressed in a specific population of GABAergic interneurons, which are believed to have a role in maintaining the balance between excitation and inhibition in the cortex as well as the hippocampus.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20°C for 1 year, store at 2-8℃ for 1 month. Avoid freeze / thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
