| Catalog No. | Size | Price (USD) |
| rp150054-10μg | 10μg | $159.90 |
| rp150054-50μg | 50μg | $377.90 |
| rp150054-100μg | 100μg | $551.90 |
| rp150054-1mg | 1mg | $3,359.90 |
Product Information
| Product Name | Recombinant Human Serpin F1/PEDF Protein |
| Short Description | Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 20-418 aa |
| Species | Human |
| Expressed Host | HEK293 |
| Accession | P36955 |
| Amino Acids | 20-418 aa |
| Protein TAG | C-His |
| Form | Lyophilized |
| Purity | ≥95% (SDS-PAGE) |
| Specifications & Purity | Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,His-Tag,≥95%(SDS-PAGE) |
| Endotoxin Concentration | <0.1 EU/μg |
| Biological Activity | Measured by its ability to enhance the adhesion of Saos‑2 human osteosarcoma cells to bovine Collagen I coated plate. The ED50 for this effect is 0.15-0.75 μg/mL. |
| SDS Page | 45 - 55 kDa, under reducing conditions; 45 - 55 kDa, under non-reducing conditions. |
| Sequence | QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGPHHHHHH |
| Synonyms | Serpine F1/Pigment Epithelium-derived Factor | Cell proliferation-inducing gene 35 protein | EPC-1 | PIG35 | PEDF | pigment epithelium-derived factor | pigment epithelium derived factor), member 1 | proliferation-inducing protein 35 | serine (or cysteine) |
Product Description
Purity
≥95% SDS-PAGE.
Endotoxin level
<0.1 EU/µg
Function
Neurotrophic protein; induces extensive neuronal differentiation in retinoblastoma cells. Potent inhibitor of angiogenesis. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.
Reconstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
