| Catalog No. | Size | Price (USD) |
| rp156014-10μg | 10μg | $142.90 |
| rp156014-50μg | 50μg | $389.90 |
| rp156014-100μg | 100μg | $514.90 |
| rp156014-1mg | 1mg | $3,399.90 |
Product Information
| Product Name | Recombinant Human SCF Protein |
| Short Description | Carrier Free, ≥95% (SDS-PAGE), Active, E. coli, No tag, 26-190 aa |
| Accession | P21583 |
| Amino Acids | 26-190 aa |
| Specifications & Purity | Carrier Free,Bioactive,ActiBioPure™,High Performance,PBS Only,≥95%(SDS-PAGE) |
| Endotoxin Concentration | <1.0 EU/μg |
| Biological Activity | Measured in a cell proliferation assay using TF 1 human erythroleukemic cells. The ED50 for this effect is 0.025 ng/mL. |
| SDS Page | 16.0 kDa, under reducing conditions; 14.3 & 16.0 kDa, under non-reducing conditions. |
| Sequence | SEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAA |
| Synonyms | c-kit Ligand | DCUA | DFNA69 | DKFZp686F2250 | familial progressive hyperpigmentation 2 | FPH2 | FPHH | KIT ligand | Kitl | KITLG | KL-1 | Mast cell growth factor | MGF | MGFSHEP7 | SCF | SCFStem cell factor | SFc-Kit ligand | SHEP7 | SLF | steel factor |
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20°C for 1 year. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
