The store will not work correctly when cookies are disabled.
Recombinant Human UBCH6/UBE2E1 Protein rp184864-10μg Aladdin
| Catalog No. | Size | Price (USD) |
| rp184864-10μg | 10μg | $259.90 |
| rp184864-50μg | 50μg | $659.90 |
| rp184864-100μg | 100μg | $1,053.90 |
| rp184864-1mg | 1mg | $5,279.90 |
Product Information
| Product Name | Recombinant Human UBCH6/UBE2E1 Protein |
| Short Description | Carrier Free, ≥90% (SDS-PAGE), E. coli, N-His tag, 2-193 aa |
| Expressed Host | E. coli |
| Accession | P51965 |
| Amino Acids | 2-193 aa |
| Protein TAG | N-His |
| Specifications & Purity | Carrier Free,His-Tag,≥90%(SDS-PAGE),See COA |
| Endotoxin Concentration | <1.0 EU/μg |
| Biological Activity | Testing in progress |
| SDS Page | 25.3 kDa, under reducing conditions; 25.3 kDa, under non-reducing conditions |
| Sequence | MHHHHHHSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT |
| Synonyms | UB2E1_HUMAN | UbcH6 | Ube2e1 | Ubiquitin carrier protein E1 | Ubiquitin conjugating enzyme E2E 1 | Ubiquitin conjugating enzyme E2E 1 (homologous to yeast UBC4/5) | Ubiquitin-conjugating enzyme E2 E1 | ubiquitin-conjugating enzyme E2E 1 (UBC4/5 homolog, y |
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
Copyright © 2025 Biogege, Inc. All rights reserved.
WhatsApp
