| Catalog No. | Size | Price (USD) |
| rp156175-10μg | 10μg | $249.90 |
| rp156175-50μg | 50μg | $667.90 |
| rp156175-100μg | 100μg | $1,069.90 |
| rp156175-1mg | 1mg | $4,771.90 |
Product Information
| Product Name | Recombinant Human PDGF-BB Protein |
| Short Description | Carrier Free, ≥95% (SDS-PAGE), Active, E. coli, N-His, 82-190 aa |
| Accession | P01127 |
| Amino Acids | 82-190 aa |
| Specifications & Purity | Carrier Free,Bioactive,ActiBioPure™,High Performance,His-Tag,≥95%(SDS-PAGE),See COA |
| Endotoxin Concentration | <1.0 EU/μg |
| Biological Activity | Measured in a cell proliferation assay using Balb/c 3T3 mouse embryonic fibroblasts. The ED50 for this effect is 9.96 ng/mL. |
| SDS Page | 13.9 kDa, under reducing conditions; 35.4 kDa, under non-reducing conditions. |
| Sequence | MGSSHHHHHHSSGLVPRGSHMSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
| Synonyms | c-sis | IBGC5 | PDGF2 | PDGF-2 | PDGFB | Platelet-derived growth factor subunit B | SIS | SSV | PDGFBB | PDGF-BB |
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in 4mM HCl. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20°C for 1 year. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| Concentration | See COA |
