| Catalog No. | Size | Price (USD) |
| rp224964-10μg | 10μg | $99.90 |
| rp224964-50μg | 50μg | $247.90 |
| rp224964-100μg | 100μg | $393.90 |
| rp224964-1mg | 1mg | $1,953.90 |
Product Information
| Product Name | Recombinant Human Superoxide Dismutase 1 Protein |
| Short Description | Carrier Free, ≥90% (SDS-PAGE), E. coli, No tag, 2-154 aa |
| Accession | P00441 |
| Amino Acids | 2-154 aa |
| Specifications & Purity | Carrier Free,PBS Only,≥90%(SDS-PAGE),See COA |
| Endotoxin Concentration | <1.0 EU/μg |
| SDS Page | 17.1 kDa, under reducing conditions; 16.6 & 34.1 kDa, under non-reducing conditions. |
| Sequence | GATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ |
| Synonyms | ALS | ALS1 | Amyotrophic lateral sclerosis 1 adult | Cu/Zn SOD | Cu/Zn superoxide dismutase | Epididymis secretory protein Li 44 | HEL S 44 | Homodimer | hSod1 | Indophenoloxidase A | IPOA | Mn superoxide dismutase | SOD | SOD soluble | SOD1 | SOD2 | SODC |
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20°C for 1 year. Avoid freeze/thaw cycle. Upon reconstitution, it is recommended to aliquot. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| Concentration | See COA |
