| Catalog No. | Size | Price (USD) |
| rp189301-10μg | 10μg | $89.90 |
| rp189301-50μg | 50μg | $269.90 |
| rp189301-100μg | 100μg | $429.90 |
| rp189301-1mg | 1mg | $2,599.90 |
Product Information
| Product Name | Recombinant Human Cdc26 / Apc12 Protein |
| Short Description | Carrier Free, ≥95% (SDS-PAGE), E. coli, N-His, 2-85 aa |
| Accession | Q8NHZ8 |
| Amino Acids | 2-85 aa |
| Specifications & Purity | Carrier Free,His-Tag,≥95%(SDS-PAGE),See COA |
| Endotoxin Concentration | <1.0 EU/μg |
| SDS Page | 14.5 kDa, under reducing conditions; 14.5 kDa, under non-reducing conditions. |
| Sequence | MHHHHHHLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF |
| Synonyms | ANAPC12 | Anaphase promoting complex subunit 12 | Anaphase promoting complex subunit CDC26 | APC12 | BWK 2 | C9orf17 | Cdc26 | CDC26 subunit of anaphase promoting complex | Cell division cycle 26 | Cell division cycle 26 homolog (S. cerevisiae) | Cell div |
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20℃ long term (12 months). Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| Concentration | See COA |
MDSD
