| Catalog No. | Size | Price (USD) |
| rp154228-10μg | 10μg | $89.90 |
| rp154228-50μg | 50μg | $239.90 |
| rp154228-1mg | 1mg | $2,759.90 |
Product Information
| Product Name | Recombinant Mouse IL-4 Protein |
| Short Description | GMP, ≥95% (SDS-PAGE), Active, HEK293, C-His, 21-140 aa |
| Species | Mouse |
| Source | Recombinant |
| Expressed Host | HEK293 |
| Accession | P07750 |
| Gene Symbol | Il4 |
| Gene ID | 16189 |
| Gene Alias | BSF-1, Il-4 |
| Protein Length | Full length protein |
| Amino Acids | 21-140 aa |
| Protein TAG | C-His |
| Form | Lyophilized |
| Purity | ＞95% (SDS-PAGE) |
| Specifications & Purity | Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His Tag,PBS Only,≥95%(SDS-PAGE) |
| Endotoxin Concentration | <1.0 EU/μg |
| Biological Activity | Measured in a cell proliferation assay using assay using CTLL‑2 mouse cytotoxic T cells. The ED₅₀ for this effect is typically <1.8ng/mL. |
| Sequence | HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYSGGGGSHHHHHHHHHH |
| Synonyms | B cell growth factor 1 | BCDF | B-cell stimulatory factor 1 | BCGF1 | BCGF-1 | binetrakin | BSF1 | BSF-1 | IL4 | IL-4 | IL-4B_cell stimulatory factor 1 | IL4E12 | interleukin 4 | interleukin-4 | Lymphocyte stimulatory factor 1 | MGC79402 | pitrakinra |
Reconstitution
Reconstitute in sterile H2O at not less than 100µg/ml, which can then be further diluted in other aqueous solutions.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20℃ for 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
