| Catalog No. | Size | Price (USD) |
| rp186550-10μg | 10μg | $91.90 |
| rp186550-50μg | 50μg | $239.90 |
| rp186550-100μg | 100μg | $357.90 |
| rp186550-1mg | 1mg | $1,539.90 |
Product Information
| Product Name | Recombinant Human FGF basic/FGF2 Protein |
| Short Description | Carrier Free, ≥90% (SDS-PAGE), Active, E. coli, No tag, 143-288 aa |
| Accession | P09038 |
| Amino Acids | 143-288 aa |
| Specifications & Purity | Carrier Free,Bioactive,ActiBioPure™,High Performance,PBS Only,≥90%(SDS-PAGE),See COA |
| Endotoxin Concentration | <1.0 EU/μg |
| Biological Activity | Measured in a cell proliferation assay using BALB/c mouse embryos cells. The ED50 for this effect is 0.21 ng/mL. |
| SDS Page | 14.9 kDa, under reducing conditions; 14.9 kDa, under non-reducing conditions |
| Sequence | APALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Synonyms | basic fibroblast growth factor bFGF | Basic fibroblast growth factor | bFGF | FGF basic | FGF2 | FGF-2 | FGFBprostatropin | fibroblast growth factor 2 (basic) | HBGF-2 | heparin-binding growth factor 2 | Prostatropin |
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| Concentration | See COA |
