| Catalog No. | Size | Price (USD) |
| rp145636-10μg | 10μg | $119.90 |
| rp145636-50μg | 50μg | $279.90 |
| rp145636-100μg | 100μg | $439.90 |
| rp145636-1mg | 1mg | $3,039.90 |
Product Information
| Product Name | Recombinant Human Ephrin-A4 Protein |
| Short Description | Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-hFc&His tag, 26-171 aa |
| Species | Human |
| Expressed Host | HEK293 |
| Accession | P52798-1 |
| Amino Acids | 26-171 aa |
| Protein TAG | C-hFc & His |
| Form | Lyophilized |
| Purity | ≥95% (SDS-PAGE) |
| Specifications & Purity | Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,His-Tag,Fc tag,≥95%(SDS-PAGE) |
| Endotoxin Concentration | <0.1 EU/μg |
| Biological Activity | 1. Immobilized Human EphA7 at 0.5 μg/mL (100 μL/well) can bind Human EFNA4 with a linear range of 0.039-0.942 ng/mL. 2. Immobilized Recombinant Human EphA2 Protein (rp181601) at 2.0 μg/mL can bind Recombinant Human Ephrin-A4 Protein (rp145636) with the EC50 of 7.41 ng/mL. 3. Immobilized Recombinant Human EphA4 Protein (rp183616) at 2.0 μg/mL can bind Human Recombinant Ephrin-A4 Protein (rp145636) with the EC50 of 8.85 ng/mL. |
| SDS Page | 50 kDa, under reducing conditions; 110 kDa, under non-reducing conditions. |
| Sequence | LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGENLYFQGMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Synonyms | EPH-related receptor tyrosine kinase ligand 4 | LERK-4 | EFL 4 | EFL4 | EFN A4 | EFNA 4 | EFNA4 | EFNA4_HUMAN | Eph related receptor tyrosine kinase ligand 4 | EPH-related receptor tyrosine kinase ligand 4 | Ephrin-A4 | EphrinA4 | EPLG4 | EPLG 4 | LERK 4 |
Product Description
Purity
≥95% (SDS-PAGE)
Endotoxin level
＜0.1 EU/μg
Function
May play a role in the interaction between activated B lymphocytes and dendritic cells in tonsils.
Reconstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
