| Catalog No. | Size | Price (USD) |
| rp146167-10μg | 10μg | $139.90 |
| rp146167-50μg | 50μg | $399.90 |
| rp146167-100μg | 100μg | $639.90 |
| rp146167-1mg | 1mg | $4,899.90 |
Product Information
| Product Name | Recombinant Human Frizzled-4 Protein |
| Short Description | Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-hFc&His tag, 37-180 aa |
| Species | Human |
| Expressed Host | HEK293 |
| Accession | Q9ULV1 |
| Amino Acids | 37-180 aa |
| Protein TAG | C-hFc & His |
| Form | Lyophilized |
| Specifications & Purity | Animal Free,Carrier Free,Bioactive,ActiBioPure™,His-Tag,Fc tag,≥95%(SDS-PAGE) |
| Endotoxin Concentration | <0.1 EU/μg |
| Biological Activity | Measured by its binding ability in a functional ELISA. In a 100 µL reaction mixture containing biotinylated rmWnt-5a at 100 ng/mL and rhFrizzled-4/Fc Chimera dilutions at 0.1-2,000 ng/mL, the concentration of rhFrizzled-4/Fc Chimera that produces 50% of the optimal binding response is found to be approximately 15-60 ng/mL. |
| SDS Page | 55 kDa, under reducing conditions; 115 kDa, under non-reducing conditions. |
| Sequence | FGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEEENLYFQGMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Synonyms | Fz-4 | FzE4 | hFz4 | CD344 | CD344 antigen | EVR1 | exudative vitreoretinopathy 1 | FEVR | frizzled (Drosophila) homolog 4 | frizzled homolog 4 (Drosophila) | Frizzled4 | Frizzled-4 | Fz-4 | FZD4 | FZD4S | FzE4 | GPCR | hFz4 | MGC34390 | WNT receptor friz |
Product Description
Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin (CTNNB1) canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin (CTNNB1) and activation of Wnt target genes. Plays a critical role in retinal vascularization by acting as a receptor for Wnt proteins and norrin (NDP). In retina, it can be both activated by Wnt protein-binding, but also by a Wnt-independent signaling via binding of norrin (NDP), promoting in both cases beta-catenin (CTNNB1) accumulation and stimulation of LEF/TCF-mediated transcriptional programs.
A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues.
Reconstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
