| Catalog No. | Size | Price (USD) |
| rp181572-10μg | 10μg | $139.90 |
| rp181572-50μg | 50μg | $399.90 |
| rp181572-100μg | 100μg | $599.90 |
| rp181572-1mg | 1mg | $2,599.90 |
Product Information
| Product Name | Recombinant Human CXCL3/GRO gamma Protein |
| Short Description | Carrier Free, ≥95% (SDS-PAGE), E. coli, No tag, 35-107 aa |
| Accession | P19876 |
| Amino Acids | 35-107 aa |
| Specifications & Purity | Carrier Free,PBS Only,≥95%(SDS-PAGE),See COA |
| Endotoxin Concentration | <1.0 EU/μg |
| SDS Page | 10.0 kDa, under reducing conditions; 10.6 kDa, under non-reducing conditions. |
| Sequence | GASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN |
| Synonyms | chemokine (C-X-C motif) ligand 3 | CINC-2 | CINC-2b | C-X-C motif chemokine 3 | CXCL3 | Dcip1 | Gm1960 | GRO gamma | GRO3 oncogene | GRO3 | GROG | GRO-gamma | GRO-gamma(1-73) | Growth-regulated protein gamma | Macrophage inflammatory protein 2-beta | mela |
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| Concentration | See COA |
