| Catalog No. | Size | Price (USD) |
| rp170430-10μg | 10μg | $89.90 |
| rp170430-50μg | 50μg | $249.90 |
| rp170430-100μg | 100μg | $399.90 |
| rp170430-1mg | 1mg | $1,999.90 |
Product Information
| Product Name | Recombinant Human FGF-10 Protein |
| Short Description | Carrier Free, ≥95% (SDS-PAGE), Active, E. coli, N-His, 40-208 aa |
| Accession | O15520 |
| Amino Acids | 40-208 aa |
| Specifications & Purity | Carrier Free,Bioactive,ActiBioPure™,High Performance,His-Tag,≥95%(SDS-PAGE),See COA |
| Endotoxin Concentration | <1.0 EU/μg |
| Biological Activity | Measured in a cell proliferation assay using MCF‑7 human breast cancer cells. The ED₅₀ for this effect is 0.77 ng/mL. |
| SDS Page | 19.9 kDa, under reducing conditions; 20.5 kDa, under non-reducing conditions. |
| Sequence | MHHHHHHLGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS |
| Synonyms | Fibroblast growth factor 10 | FGF-10 | Keratinocyte growth factor 2 | FGF10 |
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20℃ long term (6 months). Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| Concentration | See COA |
MDSD
