| Catalog No. | Size | Price (USD) |
| rp169619-10μg | 10μg | $139.90 |
| rp169619-50μg | 50μg | $399.90 |
| rp169619-100μg | 100μg | $629.90 |
| rp169619-1mg | 1mg | $4,439.90 |
Product Information
| Product Name | Recombinant Human IL-11 Protein |
| Short Description | Animal Free, ≥95% (SDS-PAGE), Active, HEK293, N-His, 22-199 aa |
| Accession | P20809 |
| Amino Acids | 22-199 aa |
| Specifications & Purity | Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,His-Tag,≥95%(SDS-PAGE),See COA |
| Endotoxin Concentration | <1.0 EU/μg |
| Biological Activity | Fully biologically active determined by the dose dependent proliferation of TF-1 cells. The ED50 for this effect is 13.28 ng/ml. |
| SDS Page | 21.1-24.2 kDa, under reducing conditions; 21.1-24.2 kDa, under non-reducing conditions. |
| Sequence | HHHHHHPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
| Synonyms | Adipogenesis inhibitory factor | AGIF | AGIFoprelvekin | IL11 | IL-11 | IL-11Oprelvekin | interleukin 11 | interleukin-11 | Oprelvekin |
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| Concentration | See COA |
