| Catalog No. | Size | Price (USD) |
| rp181559-10μg | 10μg | $89.90 |
| rp181559-50μg | 50μg | $239.90 |
| rp181559-100μg | 100μg | $389.90 |
| rp181559-1mg | 1mg | $2,089.90 |
Product Information
| Product Name | Recombinant Human CD27 Ligand/TNFSF7 Protein |
| Short Description | Animal Free, ≥90% (SDS-PAGE), Active, HEK293, C-hFc, 39-193 aa |
| Accession | P32970 |
| Amino Acids | 39-193 aa |
| Specifications & Purity | Animal Free,Carrier Free,Bioactive,ActiBioPure™,Fc tag,PBS Only,≥90%(SDS-PAGE),See COA |
| Endotoxin Concentration | <1.0 EU/μg |
| Biological Activity | Immobilized Recombinant Human CD27 Ligand/TNFSF7 Protein (rp181559) at 3.0 μg/mL can bind Cusatuzumab (anti-CD70) (Ab170844) with the EC50 of 188.8 ng/mL. |
| Sequence | QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRPPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Synonyms | CD27 Ligand | CD27-L | CD27LCD27 ligand | CD27LG | CD70 molecule | CD70 | Ki-24 antigen | surface antigen CD70 | TNFSF7 | TNFSF7CD70 antigen | tumor necrosis factor (ligand) superfamily, member 7 | Tumor necrosis factor ligand superfamily member 7 |
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20℃ for 12 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| Concentration | See COA |
