| Catalog No. | Size | Price (USD) |
| rp304477-10μg | 10μg | $89.90 |
| rp304477-50μg | 50μg | $269.90 |
| rp304477-100μg | 100μg | $429.90 |
| rp304477-1mg | 1mg | $2,599.90 |
Product Information
| Product Name | Recombinant Human IFN-alpha H2/IFNA14 Protein |
| Short Description | Carrier Free, ≥95% (SDS-PAGE), E. coli, No tag, 24-189 aa |
| Accession | P01570 |
| Amino Acids | 24-189 aa |
| Specifications & Purity | Carrier Free,≥95%(SDS-PAGE),See COA |
| Endotoxin Concentration | <1.0 EU/μg |
| Biological Activity | Testing in progress |
| SDS Page | 18.4 kDa, under reducing conditions; 15.7 & 31.2 kDa, under non-reducing conditions. |
| Sequence | GCNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD |
| Synonyms | IFNA14 | IFNalpha H2 | IFN-alpha H2 | IFN-alpha-14 | IFN-alphaH | interferon alpha-14 | Interferon alpha-H | Interferon lambda-2-H | interferon, alpha 14 | LeIF H | LEIF2H | MGC125756 | MGC125757 |
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20℃ for 6 months. Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Additional Information
| Concentration | See COA |
