| Catalog No. | Size | Price (USD) |
| rp154012-10μg | 10μg | $239.90 |
| rp154012-20μg | 20μg | $379.90 |
| rp154012-100μg | 100μg | $628.90 |
| rp154012-1mg | 1mg | $3,379.90 |
| rp154012-500μg | 500μg | $2,459.90 |
Product Information
| Product Name | Recombinant Mouse G-CSF Protein |
| Short Description | Carrier Free, >97%(SDS-PAGE, HPLC), Active, E.coli, No tag, 31-208aa |
| Species | Mouse |
| Expressed Host | E.coli |
| Accession | P09920 |
| Gene Symbol | Csf3 |
| Gene ID | 12985 |
| Gene Alias | Csfg; G-CSF; MGI-IG |
| Amino Acids | 31-208 aa |
| Protein TAG | No tag |
| Form | Lyophilized |
| Purity | ＞97%(SDS-PAGE, HPLC) |
| Specifications & Purity | ActiBioPure™, Bioactive, Carrier Free, Azide Free, High performance, ≥97%(SDS-PAGE&HPLC) |
| Endotoxin Concentration | <0.1 EU/μg |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine NFS-60 cells is less than 0.05ng/ml, corresponding to a specific activity of >2.0 ×10⁷ IU/mg. |
| SDS Page | 20.2 kDa, under reducing conditions; 20.2 kDa, under non-reducing conditions. |
| Sequence | VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPK ASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQ MENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA |
| Synonyms | C17orf33 | chromosome 17 open reading frame 33 | colony stimulating factor 3 (granulocyte) | CSF3 | CSF3OS | Filgrastim | GCSF | G-CSF | GCSFlenograstim | granulocyte colony-stimulating factor | Lenograstim | MGC45931 | Pluripoietin | Csfg | MGI-IG |
Product Description
Granulocyte colony stimulating factor (G-CSF) is a pleiotropic cytokine. It is mainly produced by monocytes and macrophages upon activation by endotoxin, TNF-α and IFN-γ. Besides, many other cell types can secret this protein after activation by LPS, IL-1 or TNF-α. Various carcinoma cell lines and myeloblastic leukemia cells can express G-CSF constitutively. G-CSF is cytokine that acts in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. In addition, it may function in some adhesion or recognition events at the cell surface. Human G-CSF is 73% identical at the amino acid level to murine G-CSF and the two proteins show species cross-reactivity. Recombinant murine G-CSF is an 18.9kDa polypeptide containing 178 amino acid residues.
Purity
>97% SDS-PAGE
Function
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes.
Reconstitution
1、This vial mustbebriefly centrifuged prior to opening to bring the contents to the bottom。2、Reconstitute in asterile aqueous buffer to anappropriateconcentration。3、Stock solutions should be apportioned into working aliquots and stored at ≤ -20°C. Further dilutions should be made in appropriate buffered solutions。
Storage and Shipping
| Shipped In | Dry ice packs + Cold packs |
| Stability and Storage | Shipped at 4°C. Lyophilized from a 0.2μm filtered solution in 10mM Sodium Citrate, pH4.0, 150mM NaCl, 0.01% Tween-20. Store at -80°C. Avoid freeze / thaw cycle. |
| Storage Temp | Store at -80°C |
