| Catalog No. | Size | Price (USD) |
| rp144040-10μg | 10μg | $139.90 |
| rp144040-50μg | 50μg | $379.90 |
| rp144040-100μg | 100μg | $619.90 |
| rp144040-1mg | 1mg | $3,999.90 |
Product Information
| Product Name | Recombinant human CD48 protein |
| Short Description | Animal Free, ≥95% (SDS-PAGE), Active, HEK293, C-His tag, 27-220 aa |
| Species | Human |
| Expressed Host | HEK293 |
| Accession | P09326-1 |
| Gene Symbol | CD48 |
| Gene ID | 962 |
| Amino Acids | 27-220 aa |
| Protein TAG | C-His |
| Form | lyophilized powder |
| Purity | ≥95% (SDS-PAGE) |
| Specifications & Purity | Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,His-Tag,≥95%(SDS-PAGE) |
| Endotoxin Concentration | <1.0 EU/μg |
| Biological Activity | Measured by its ability to bind recombinant human CD244. Immobilized recombinant human CD48 at 5 μg/mL (100 μL/well) can bind recombinant human CD244 with a linear range of 0.2-1 μg/mL. |
| SDS Page | 35-42 kDa, under reducing conditions |
| Sequence | QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSHHHHHH |
| Synonyms | BCM1 surface antigen | BCM1 | BCM1Leukocyte antigen MEM-102 | BLAST | BLAST1 | BLAST1TCT.1 | B-lymphocyte activation marker BLAST-1 | CD48 antigen (B-cell membrane protein) | CD48 antigen | CD48 molecule | CD48 | hCD48 | mCD48 | MEM-102 | SLAMF2 | Antigen |
Product Description
Purity
≥95% (SDS-PAGE)
Endotoxin level
＜1.0 EU/μg
Function
Ligand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in regulating T-cell activation.
Reconstitution
Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
