| Catalog No. | Size | Price (USD) |
| rp176706-10μg | 10μg | $111.90 |
| rp176706-100μg | 100μg | $527.90 |
| rp176706-1mg | 1mg | $3,399.90 |
Product Information
| Product Name | Recombinant Human p27 KIP 1 Protein |
| Short Description | Carrier Free, >95% SDS-PAGE, E.coli, His, 1-198 aa |
| Expressed Host | E. coli |
| Accession | P46527 |
| Gene Symbol | CDKN1B |
| Gene ID | 1027 |
| Amino Acids | 1-198 aa |
| Protein TAG | N-His |
| Form | Lyophilized |
| Purity | >95% SDS-PAGE |
| Specifications & Purity | Carrier Free,Azide Free,His Tag,PBS Only,≥95%(SDS-PAGE) |
| Endotoxin Concentration | <1.0 EU/μg |
| SDS Page | 29.7 kDa, reducing conditions; 26.7 and 29.4 kDa，non-reducing condition |
| Sequence | MGSSHHHHHHSSGLVPRGSHMSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT |
| Synonyms | Cyclin-dependent kinase inhibitor 1B | Cyclin-dependent kinase inhibitor p27 | p27Kip1 | AA408329 | AI843786 | Cdki1b | CDKN 1B | CDKN 4 | CDKN1B | CDKN4 | CDN1B_HUMAN | Cyclin Dependent Kinase Inhibitor 1B | Cyclin dependent kinase inhibitor p27 | Cyclin |
Product Description
Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：
Cyclin-Dependent Kinase Inhibitor 1B (CDKN1B) is a Kinesin-related motor protein necessary for mitotic spindle assembly and chromosome segregation. CDKN1B is expressed in all tissues with highest levels observed in skeletal muscle. CDKN1B is a potent inhibitor of Cyclin E- and Cyclin A-CDK2 complexes. CDKN1B forms a complex with Cyclin Type D-CDK4 complexes and is involved in the assembly, stability, and modulation of CCND1-CDK4 complex activation. In addition, CDKN1B acts as an inhibitor or an activator of Cyclin Type D-CDK4 complexes depending on its phosphorylation state and stoichometry.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
