| Catalog No. | Size | Price (USD) |
| rp175904-10μg | 10μg | $139.90 |
| rp175904-50μg | 50μg | $399.90 |
| rp175904-100μg | 100μg | $699.90 |
| rp175904-1mg | 1mg | $4,999.90 |
Product Information
| Product Name | Recombinant Human CD68 Protein |
| Short Description | Animal Free, >90% (SDS-PAGE), 293F cell, C-His tag, 22-319 aa |
| Expressed Host | HEK293 |
| Accession | P34810 |
| Amino Acids | 22-319 aa |
| Protein TAG | C-His |
| Form | Lyophilized |
| Specifications & Purity | Animal Free,Carrier Free,Azide Free,His Tag,PBS Only,≥90%(SDS-PAGE) |
| Endotoxin Concentration | <1.0 EU/μg |
| SDS Page | 72.9-125.0 kDa, under reducing conditions; 72.9-125.0 kDa, under non-reducing conditions |
| Sequence | NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRSHHHHHH |
| Synonyms | CD_antigen: CD68 | CD68 antigen | CD68 molecule | CD68 | DKFZp686M18236 | gp110 | LAMP4 | macrophage antigen CD68 | Macrosialin | SCARD1 | SRD1 | scavenger receptor class D, member 1 | SR-D1 | CD 68 | CD68_HUMAN |
Product Description
Purity:>90%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：
Macrosialin, also known as CD68 and Gp11, is a single-pass type I membrane protein which belongs to theLAMP family. CD68 is highly expressed by blood monocytes and tissue macrophages. It is also expressed in lymphocytes, fibroblasts and endothelial cells. CD68 is expressed in many tumor cell lines which could allow them to attach to selectins on vascular endothelium, facilitating their dissemination to secondary sites. CD68 plays a role in phagocytic activities of tissue macrophages, both in intracellular lysosomal metabolism and extracellular cell-cell and cell-pathogen interactions. It is a commonly used marker for macrophages. However, a number of studies have shown that CD68 antibodies react with other hematopoietic and non-hematopoietic cell types, suggesting that CD68 may not be a macrophage-specific antigen.
CD68 binds to tissue- and organ-specific lectins or selectins, allowing homing of macrophage subsets to particular sites. Rapid recirculation of CD68 from endosomes and lysosomes to the plasma membrane may allow macrophages to crawl over selectin-bearing substrates or other cells.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage and Shipping
| Shipped In | Ice chest + Ice pads |
| Stability and Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
